PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00011217001
Common NameGSBRNA2T00011217001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 602aa    MW: 65257.6 Da    PI: 6.3102
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00011217001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.82.1e-12167228162
                          XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          e++ k+  r+ +NRe+A+ sRqRKk ++eeLeekv  + +  ++L  +++    e a+l+++
  GSBRNA2T00011217001 167 EEDEKKKARLVRNRESAQLSRQRKKHYVEELEEKVRHMHSTITDLNGKISFFMAENATLRQQ 228
                          6788999*********************************9999999999999999888886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15167231IPR004827Basic-leucine zipper domain
PfamPF001704.3E-11168229IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.105169229IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-12171229No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-16171229No hitNo description
CDDcd147041.24E-21172223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MSQSITEEPP PPSSDSFSIP PFDDQFHHQT PIGELMSDLG FPIDGDFELT FDGMEDVYLP  60
AENETFLIPG NQEQFGDFTP ESEGSGDCLP KDADKSKSAT PLSSQGSGNC GSDVSEGTTV  120
VDQKVKVEAT TTSVTKRKKE EIEEDMSDES RSSKYRRSGE ESAVTGEEDE KKKARLVRNR  180
ESAQLSRQRK KHYVEELEEK VRHMHSTITD LNGKISFFMA ENATLRQQLG GSGMCPPPPM  240
GMYPPMAPMA YPWMPCPPYM MKQQGSQVPL IPIPRLKPQN PMGSETKTKK VASISVLGLV  300
FCLFLFGALA PVVNVNYGGI SGAFYGNYRS NYVTDQIYSQ QHRNRVLDTS RSSCAGSGVS  360
NISAPPGNGS EPLVASLFVP RNDKLVKIDG NLIINSILAS EKAVASRKAS ESSERKAADP  420
AVVTKDYHPA LPLPEVGKIK TKAANGEMQQ WFREGVAGPM FSSGMCTEVF QFDVSSTSGA  480
IIPASPAANV SAEHSKNATD THRRKNRRTL RGLPIPLPGS DFNFTKEHQR NSSSKEIKPA  540
SSMVVSVLVD PREGGDGDID GMIGGPKSLS RVFVVVLVDS AKYVTYSCVL PRSGAPHLVT  600
T*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.148531e-151seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692497.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A078IXC70.0A0A078IXC7_BRANA; BnaC04g52230D protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]